PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000241967
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 198aa    MW: 22735.7 Da    PI: 10.22
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000241967genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY38.81.9e-12145184140
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkver 40 
                    ldDgy+WrKYGqK vk+s +pr Y++   ++    k+++ 
  MDP0000241967 145 LDDGYRWRKYGQKAVKNSSYPRFYHKERIKNIVKSKQIKX 184
                    59************************99999888888875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.5E-14131184IPR003657WRKY domain
SuperFamilySSF1182902.75E-11137181IPR003657WRKY domain
PROSITE profilePS5081114.366140183IPR003657WRKY domain
SMARTSM007742.6E-5145192IPR003657WRKY domain
PfamPF031066.3E-8146173IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MDEPSEQLQN LKSLNSLLLK ETKDRQQQVE SLVQGKAYLE SELLVDFANS LQRRSFDIWS  60
FREDIDWVSL LSGGTQAAGG XNHDQINSFK PMXMMDNNIS GSAWNTGADQ EEKVGVKRKG  120
GXKMRKAAAS RPRFAFQTRS EDDILDDGYR WRKYGQKAVK NSSYPRFYHK ERIKNIVKSK  180
QIKXKVKYCC KNGSKSSH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008344897.12e-70PREDICTED: probable WRKY transcription factor 43
RefseqXP_008354007.15e-70PREDICTED: probable WRKY transcription factor 24
TrEMBLM5X3041e-33M5X304_PRUPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32273471
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46130.15e-17WRKY DNA-binding protein 43